PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.2NG431600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 865aa    MW: 90817.6 Da    PI: 6.2407
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.2NG431600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox681.2e-21132187156
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          +++ +++t++q++eLe++F+++++p++++r eL+k+l+L+ rqVk+WFqNrR+++k
  Pavir.2NG431600.1.p 132 KKRYHRHTPQQIQELEAVFKECPHPDEKQRMELSKRLNLESRQVKFWFQNRRTQMK 187
                          688999***********************************************999 PP

2START169.62.1e-533535854205
                          HHHHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EE CS
                START   4 eeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                          ++a++el+k a+ +ep+W  s+     e +n de+++ f++  +     +  ea r+ gv +  +++lv +l+d + +W+e+++    +a
  Pavir.2NG431600.1.p 353 LAAMEELMKVAQMDEPLWLPSPdggglETLNLDEYRRAFARVLGpspagYVAEATREAGVAITSSVDLVDSLMDAA-RWSEMFPcivaRA 441
                          789************************************886669*******************************.************* PP

                          EEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--............-TTSEE-EESSEE CS
                START  80 etlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe...........sssvvRaellpSg 151
                          +t++ issg      g +qlm +elq+lsplvp R++vf+R+++q+ +g w++vdvSvd    p              ++++ ++llpSg
  Pavir.2NG431600.1.p 442 STTDIISSGmggtrsGSIQLMHTELQVLSPLVPiREVVFLRFCKQHAEGLWAVVDVSVDAVLRPGGdphhhplngggAAGYMGCRLLPSG 531
                          **********************************************************975443222222222578889*********** PP

                          EEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
                START 152 iliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                          ++++++ ng+skvtwv h++++++ +h+l+r+l++sg+a ga++w+a lqrqc+
  Pavir.2NG431600.1.p 532 CVVQDMNNGYSKVTWVVHAEYDEAAVHQLYRPLLRSGQALGARRWLASLQRQCQ 585
                          *****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.01E-22114189IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.1E-23119189IPR009057Homeodomain-like
PROSITE profilePS5007118.301129189IPR001356Homeobox domain
SMARTSM003898.7E-20130193IPR001356Homeobox domain
CDDcd000866.75E-20132189No hitNo description
PfamPF000464.1E-19132187IPR001356Homeobox domain
PROSITE patternPS000270164187IPR017970Homeobox, conserved site
PROSITE profilePS5084840.261341589IPR002913START domain
CDDcd088751.63E-103347585No hitNo description
SuperFamilySSF559612.12E-28348585No hitNo description
SMARTSM002344.0E-41350586IPR002913START domain
PfamPF018522.8E-45353585IPR002913START domain
SuperFamily